General Information

  • ID:  hor005334
  • Uniprot ID:  P23063
  • Protein name:  Glucagon-like peptide
  • Gene name:  NA
  • Organism:  Hydrolagus colliei (Spotted ratfish) (Chimaera colliei)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hydrolagus (genus), Chimaeridae (family), Chimaeriformes (order), Holocephali (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HADGIYTSDVASLTDYLKSKRFVESLSNYNKRQNDRRM
  • Length:  38
  • Propeptide:  HADGIYTSDVASLTDYLKSKRFVESLSNYNKRQNDRRM
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P23063-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P23063-F1.pdbhor005334_AF2.pdbhor005334_ESM.pdb

Physical Information

Mass: 514008 Formula: C192H305N59O63S
Absent amino acids: CPW Common amino acids: S
pI: 9.7 Basic residues: 8
Polar residues: 14 Hydrophobic residues: 9
Hydrophobicity: -109.21 Boman Index: -13305
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 61.58
Instability Index: 4741.58 Extinction Coefficient cystines: 4470
Absorbance 280nm: 120.81

Literature

  • PubMed ID:  2646172
  • Title:  Multiple molecular forms of insulin and glucagon-like peptide from the Pacific ratfish (Hydrolagus colliei).